PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619076.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 319aa    MW: 35941.7 Da    PI: 6.5109
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619076.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +v+++G g W+t + + g++R++k+c++rw +yl
   XP_013619076.1 26 KGAWTQEEDHKLIAYVQLHGEGGWRTLPDKAGLRRCGKSCRLRWANYL 73
                     79********************************************97 PP

2Myb_DNA-binding56.46.9e-1879123147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++ ++++++ +G++ W++Iar+++ gRt++++k++w+++
   XP_013619076.1  79 RGEFSEEEQDSIIRLHAIHGNK-WSAIARRLP-GRTDNEIKNHWNTH 123
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3732173IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-222276IPR009057Homeodomain-like
SuperFamilySSF466892.25E-2923120IPR009057Homeodomain-like
SMARTSM007171.2E-112575IPR001005SANT/Myb domain
PfamPF002491.9E-152673IPR001005SANT/Myb domain
CDDcd001671.64E-82873No hitNo description
PROSITE profilePS5129426.68274128IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2677129IPR009057Homeodomain-like
SMARTSM007173.9E-1778126IPR001005SANT/Myb domain
PfamPF002492.6E-1679123IPR001005SANT/Myb domain
CDDcd001671.17E-1281124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MFSSKDQVLP SYDPTQNHNT AEGLKKGAWT QEEDHKLIAY VQLHGEGGWR TLPDKAGLRR  60
CGKSCRLRWA NYLRPDIKRG EFSEEEQDSI IRLHAIHGNK WSAIARRLPG RTDNEIKNHW  120
NTHIKKRLVK KGIDPLTHKS LNGKSSDHTE TPPDKSSVHQ DDDDQKSNKN NALGSLSARF  180
LNRVANRFGK RINHSVLSDI INGSGAPFTS HTTPTTSASE CEKSSSSFST PNSSNLLINE  240
NMVLDATSLS SSTFSSDTSD PSVYDHIFDD LEDMTTFSSR FLNDVVSHDD VDFLMLDESC  300
LENTSFMREL TRILQEDYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27241285108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701200.0KJ670120.1 Brassica napus MYB transcription factor 122 (MYB122.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619076.10.0PREDICTED: transcription factor MYB122 isoform X2
SwissprotQ9C9C81e-144MY122_ARATH; Transcription factor MYB122
TrEMBLA0A0D3AQF40.0A0A0D3AQF4_BRAOL; Uncharacterized protein
STRINGBra008131.1-P1e-174(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-128myb domain protein 122